Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP6 Rabbit Polyclonal Antibody (HRP)

USP6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HRP1, TRE2, TRE17, Tre-2, TRESMCR, USP6-short

UniProt

P35125

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human USP6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NHSEEDSTDDQREDTHIKPIYNLYAISCHSGILSGGHYITYAKNPNCKWY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

119kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USF2, ID (Upstream Stimulatory Factor 2, Upstream Transcription Factor 2, FOS-interacting Protein, FIP, Major Late Transcription Factor 2, Class B Basic Helix-loop-helix Protein 12, bHLHb12) (MaxLight 405)
MBS6504831-01 0.1 mL

USF2, ID (Upstream Stimulatory Factor 2, Upstream Transcription Factor 2, FOS-interacting Protein, FIP, Major Late Transcription Factor 2, Class B Basic Helix-loop-helix Protein 12, bHLHb12) (MaxLight 405)

Sign In for Pricing
View Details
USF2, ID (Upstream Stimulatory Factor 2, Upstream Transcription Factor 2, FOS-interacting Protein, FIP, Major Late Transcription Factor 2, Class B Basic Helix-loop-helix Protein 12, bHLHb12) (MaxLight 405)
MBS6504831-02 5x 0.1 mL

USF2, ID (Upstream Stimulatory Factor 2, Upstream Transcription Factor 2, FOS-interacting Protein, FIP, Major Late Transcription Factor 2, Class B Basic Helix-loop-helix Protein 12, bHLHb12) (MaxLight 405)

Sign In for Pricing
View Details
HOOK2 Protein Vector (Human) (pPB-C-His)
PV020161 500 ng

HOOK2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
ALR2-IN-7
T212198-01 10 mg

ALR2-IN-7

Sign In for Pricing
View Details
ALR2-IN-7
T212198-02 50 mg

ALR2-IN-7

Sign In for Pricing
View Details
1-Acetamido-4-phenylcyclohexane-1-carboxylic acid
XJC09485-01 50 mg

1-Acetamido-4-phenylcyclohexane-1-carboxylic acid

Sign In for Pricing
View Details