Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMD9 Rabbit Polyclonal Antibody (Biotin)

PSMD9 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P27, Rpn4

UniProt

O00233

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PSMD9

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QSLHNIGSVVQHSEGKPLNVTVIRRGEKHQLRLVPTRWAGKGLLGCNIIP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002804

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF410 Pre-designed siRNA Set A
SI018796A 1 Each

Human ZNF410 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Lentiviral human ERCC4 sgRNA gene knockout kit - Lentiviral human ERCC4 sgRNA gene knockout kit (100)
GTR15385225 1 Vial

Lentiviral human ERCC4 sgRNA gene knockout kit - Lentiviral human ERCC4 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
L-Phenylalanine cyclohexylamide 99+% (TLC)
239375-01 1 g

L-Phenylalanine cyclohexylamide 99+% (TLC)

Sign In for Pricing
View Details
L-Phenylalanine cyclohexylamide 99+% (TLC)
239375-02 5 g

L-Phenylalanine cyclohexylamide 99+% (TLC)

Sign In for Pricing
View Details
Annexin IV Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-61904R-BF594-TR 20 µL

Annexin IV Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
CST7 Polyclonal Antibody
MBS9128603-01 0.02 mL

CST7 Polyclonal Antibody

Sign In for Pricing
View Details