Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AIMP2 Rabbit Polyclonal Antibody (Biotin)

AIMP2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P38, JTV1, HLD17, JTV-1

UniProt

Q13155

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human AIMP2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_006294

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GMFB siRNA (Mouse)
orb1843019-01 15 nmol

GMFB siRNA (Mouse)

Sign In for Pricing
View Details
GMFB siRNA (Mouse)
orb1843019-02 30 nmol

GMFB siRNA (Mouse)

Sign In for Pricing
View Details
LOC100041102 siRNA (m)
sc-147533 10 µM

LOC100041102 siRNA (m)

Sign In for Pricing
View Details
NDUFS4 (NADH Dehydrogenase (Ubiquinone) Fe-S Protein 4, Mitochondrial, NADH-Ubiquinone Oxidoreductase 18kD Subunit, Complex I-18kD, CI-18kD, Complex I-AQDQ, CI-AQDQ) (Biotin)
130240-Biotin 100 µL

NDUFS4 (NADH Dehydrogenase (Ubiquinone) Fe-S Protein 4, Mitochondrial, NADH-Ubiquinone Oxidoreductase 18kD Subunit, Complex I-18kD, CI-18kD, Complex I-AQDQ, CI-AQDQ) (Biotin)

Sign In for Pricing
View Details
EpmA Antibody
orb814218 2 mg

EpmA Antibody

Sign In for Pricing
View Details
C-Myc Oncoprotein Class E basic helix-loop-helix protein 39 (bHLHe39), MRTL, Myc2, Niard, Nird, Proto-oncogene c-Myc, RNCMYC, Transcription factor p64, Transcriptional regulator Myc-A, V-Myc avian myelocytomatosis viral oncogene homolog (BSA & Azide Free) (MaxLight 550)
168655-AF-ML550 100 µL

C-Myc Oncoprotein Class E basic helix-loop-helix protein 39 (bHLHe39), MRTL, Myc2, Niard, Nird, Proto-oncogene c-Myc, RNCMYC, Transcription factor p64, Transcriptional regulator Myc-A, V-Myc avian myelocytomatosis viral oncogene homolog (BSA & Azide Free) (MaxLight 550)

Sign In for Pricing
View Details