Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cops3 Rabbit Polyclonal Antibody (Biotin)

Cops3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q68FW9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Cops3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NIQRLTKTFLTLSLQDMASRVQLSGPQEAEKYVLHMIEDGEIFASINQKD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001004200

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-EPLIN/LIMA1 Antibody Picoband® (Dylight488 Conjugate)
A05231-1-Dylight488 100 µg

Anti-EPLIN/LIMA1 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Lentiviral human GSTA4 shRNA (UAS) - Lentiviral human GSTA4 shRNA (UAS, RFP) plasmid
GTR15117193 1 Vial

Lentiviral human GSTA4 shRNA (UAS) - Lentiviral human GSTA4 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
AKR1E2, CT (AKR1E2, AKR1CL2, AKRDC1, 1,5-anhydro-D-fructose reductase, Aldo-keto reductase family 1 member C-like protein 2, Aldo-keto reductase family 1 member E2, LoopADR, Testis-specific protein) (MaxLight 490) discontinued
031748-ML490 100 µL

AKR1E2, CT (AKR1E2, AKR1CL2, AKRDC1, 1,5-anhydro-D-fructose reductase, Aldo-keto reductase family 1 member C-like protein 2, Aldo-keto reductase family 1 member E2, LoopADR, Testis-specific protein) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Ninjurin 2 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb873587 100 µL

Ninjurin 2 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
Human QSOX2 Knockout HEK293T cell line
GTR15413402 1 Vial

Human QSOX2 Knockout HEK293T cell line

Sign In for Pricing
View Details
Human Jagged 1 HEK293 Overexpression Lysate
MBS8114628-01 0.3 mg

Human Jagged 1 HEK293 Overexpression Lysate

Sign In for Pricing
View Details