Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cops3 Rabbit Polyclonal Antibody (FITC)

Cops3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q68FW9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Cops3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NIQRLTKTFLTLSLQDMASRVQLSGPQEAEKYVLHMIEDGEIFASINQKD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001004200

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Guinea pig IgG (H&L), Biotin conjugated Antibody
orb700278 2 mg

Goat Guinea pig IgG (H&L), Biotin conjugated Antibody

Sign In for Pricing
View Details
DNAI1, NT (DNAI1, Dynein intermediate chain 1, axonemal, Axonemal dynein intermediate chain 1) (Biotin)
MBS6292577-01 0.2 mL

DNAI1, NT (DNAI1, Dynein intermediate chain 1, axonemal, Axonemal dynein intermediate chain 1) (Biotin)

Sign In for Pricing
View Details
DNAI1, NT (DNAI1, Dynein intermediate chain 1, axonemal, Axonemal dynein intermediate chain 1) (Biotin)
MBS6292577-02 5x 0.2 mL

DNAI1, NT (DNAI1, Dynein intermediate chain 1, axonemal, Axonemal dynein intermediate chain 1) (Biotin)

Sign In for Pricing
View Details
CEACAM6 Peptide - N-terminal region (AAP41503)
AAP41503-100UG 100 µg

CEACAM6 Peptide - N-terminal region (AAP41503)

Sign In for Pricing
View Details
Mucin 6 CRISPR Activation Plasmid (h2)
sc-402946-ACT-2 20 µg

Mucin 6 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
CD99 Mouse Monoclonal Antibody [Clone ID: OTI4A5]
TA800911S 30 µL

CD99 Mouse Monoclonal Antibody [Clone ID: OTI4A5]

Sign In for Pricing
View Details