Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COPS6 Rabbit Polyclonal Antibody (Biotin)

COPS6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CSN6, MOV34-34KD

UniProt

Q7L5N1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human COPS6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LILEYVKASEAGEVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_006824

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSH2 (MutS Homolog 2, Mismatch Repair Protein 2, Familial Nonpolyposis Colon Cancer Type 1, COCA1, FCC1, HNPCC, HNPCC1, LCFS2) (MaxLight 405)
MBS6427469-01 0.1 mL

MSH2 (MutS Homolog 2, Mismatch Repair Protein 2, Familial Nonpolyposis Colon Cancer Type 1, COCA1, FCC1, HNPCC, HNPCC1, LCFS2) (MaxLight 405)

Sign In for Pricing
View Details
MSH2 (MutS Homolog 2, Mismatch Repair Protein 2, Familial Nonpolyposis Colon Cancer Type 1, COCA1, FCC1, HNPCC, HNPCC1, LCFS2) (MaxLight 405)
MBS6427469-02 5x 0.1 mL

MSH2 (MutS Homolog 2, Mismatch Repair Protein 2, Familial Nonpolyposis Colon Cancer Type 1, COCA1, FCC1, HNPCC, HNPCC1, LCFS2) (MaxLight 405)

Sign In for Pricing
View Details
Human PNRC2 Recombinant Protein
PROTQ9NPJ4-500ug 500 µg

Human PNRC2 Recombinant Protein

Sign In for Pricing
View Details
Camel Dipeptidase 2 ELISA Kit
MBS061982-01 48 Well

Camel Dipeptidase 2 ELISA Kit

Sign In for Pricing
View Details
Camel Dipeptidase 2 ELISA Kit
MBS061982-02 96 Well

Camel Dipeptidase 2 ELISA Kit

Sign In for Pricing
View Details
Camel Dipeptidase 2 ELISA Kit
MBS061982-03 5x 96 Well

Camel Dipeptidase 2 ELISA Kit

Sign In for Pricing
View Details