Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COPS6 Rabbit Polyclonal Antibody (FITC)

COPS6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CSN6, MOV34-34KD

UniProt

Q7L5N1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human COPS6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DHVARMTATGSGENSTVAEHLIAQHSAIKMLHSRVKLILEYVKASEAGEV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006824

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DIS3L2 (NM_152383) Human Tagged ORF Clone Lentiviral Particle
RC205512L4V 200 µL

DIS3L2 (NM_152383) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Monoclonal MUC1 Antibody (604804) [Janelia Fluor 646]
FAB6298J 0.1 mL

Mouse Monoclonal MUC1 Antibody (604804) [Janelia Fluor 646]

Sign In for Pricing
View Details
Human Atrial Natriuretic Peptide ELISA Kit (ANP)
RK00890 96 Tests

Human Atrial Natriuretic Peptide ELISA Kit (ANP)

Sign In for Pricing
View Details
MEF2A (NM_001130927) Human Tagged ORF Clone
RG225717 10 µg

MEF2A (NM_001130927) Human Tagged ORF Clone

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Cystathionine Gamma Lyase (CSE)
MBS2056297-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Cystathionine Gamma Lyase (CSE)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Cystathionine Gamma Lyase (CSE)
MBS2056297-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Cystathionine Gamma Lyase (CSE)

Sign In for Pricing
View Details