Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nae1 Rabbit Polyclonal Antibody (Biotin)

Nae1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ap, 59kDa, Appbp1

UniProt

Q8VBW6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Nae1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ARALKEFVAKEGQGNLPVRGTIPDMIADSNKYIKLQNVYREKAKKDAAAV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_659180

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCAS2, NT (BCAS2, DAM1, Pre-mRNA-splicing factor SPF27, Breast carcinoma-amplified sequence 2, DNA amplified in mammary carcinoma 1 protein, Spliceosome-associated protein SPF 27) (Azide free) (HRP)
MBS6277794-01 0.2 mL

BCAS2, NT (BCAS2, DAM1, Pre-mRNA-splicing factor SPF27, Breast carcinoma-amplified sequence 2, DNA amplified in mammary carcinoma 1 protein, Spliceosome-associated protein SPF 27) (Azide free) (HRP)

Sign In for Pricing
View Details
BCAS2, NT (BCAS2, DAM1, Pre-mRNA-splicing factor SPF27, Breast carcinoma-amplified sequence 2, DNA amplified in mammary carcinoma 1 protein, Spliceosome-associated protein SPF 27) (Azide free) (HRP)
MBS6277794-02 5x 0.2 mL

BCAS2, NT (BCAS2, DAM1, Pre-mRNA-splicing factor SPF27, Breast carcinoma-amplified sequence 2, DNA amplified in mammary carcinoma 1 protein, Spliceosome-associated protein SPF 27) (Azide free) (HRP)

Sign In for Pricing
View Details
ELMO3 Rabbit Polyclonal Antibody (PE-Cy7)
orb944056 100 µL

ELMO3 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
CD1d (CD1d Antigen, CD1d Antigen D Polypeptide, R3, R3G1, Thymocyte Antigen CD1d) (Biotin) discontinued
C2252-04E-Biotin 100 µL

CD1d (CD1d Antigen, CD1d Antigen D Polypeptide, R3, R3G1, Thymocyte Antigen CD1d) (Biotin) discontinued

Sign In for Pricing
View Details
LAD1 Rabbit Polyclonal Antibody (Cy5.5)
orb1062723 100 µL

LAD1 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Recombinant EpCAM Antibody / Cytoplasmic domain
orb1151838-01 20 µg

Recombinant EpCAM Antibody / Cytoplasmic domain

Sign In for Pricing
View Details