Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nae1 Rabbit Polyclonal Antibody (FITC)

Nae1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ap, 59kDa, Appbp1

UniProt

Q8VBW6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Nae1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ARALKEFVAKEGQGNLPVRGTIPDMIADSNKYIKLQNVYREKAKKDAAAV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_659180

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRBP2 (Nuclear Receptor Binding Protein 2, DKFZp434P086, MGC138699, TRG16, pp9320) (MaxLight 750) discontinued
249491-ML750 100 µL

NRBP2 (Nuclear Receptor Binding Protein 2, DKFZp434P086, MGC138699, TRG16, pp9320) (MaxLight 750) discontinued

Sign In for Pricing
View Details
BCOR Protein Vector (Human) (pPM-N-D-C-HA)
PV326636 500 ng

BCOR Protein Vector (Human) (pPM-N-D-C-HA)

Sign In for Pricing
View Details
SPC24 Protein Vector (Mouse) (pPM-C-His)
PV233157 500 ng

SPC24 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
ZSWIM2, CT (ZSWIM2, ZZZ2, E3 ubiquitin-protein ligase ZSWIM2, MEKK1-related protein X, ZZ-type zinc finger-containing protein 2, Zinc finger SWIM domain-containing protein 2)
MBS642509-01 0.2 mL

ZSWIM2, CT (ZSWIM2, ZZZ2, E3 ubiquitin-protein ligase ZSWIM2, MEKK1-related protein X, ZZ-type zinc finger-containing protein 2, Zinc finger SWIM domain-containing protein 2)

Sign In for Pricing
View Details
ZSWIM2, CT (ZSWIM2, ZZZ2, E3 ubiquitin-protein ligase ZSWIM2, MEKK1-related protein X, ZZ-type zinc finger-containing protein 2, Zinc finger SWIM domain-containing protein 2)
MBS642509-02 5x 0.2 mL

ZSWIM2, CT (ZSWIM2, ZZZ2, E3 ubiquitin-protein ligase ZSWIM2, MEKK1-related protein X, ZZ-type zinc finger-containing protein 2, Zinc finger SWIM domain-containing protein 2)

Sign In for Pricing
View Details
Mouse X-Ray Repair Cross Complementing 6 (XRCC6) Antibody Pair Kit (with Standard)
MBS2098779-01 5x 96 Tests

Mouse X-Ray Repair Cross Complementing 6 (XRCC6) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details