Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBA6 Rabbit Polyclonal Antibody (Biotin)

UBA6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

E1-L2, MOP-4, UBE1L2

UniProt

A0AVT1

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence SNKVVQTDETARKPDHVPISSEDERNAIFQLEKAILSNEATKSDLQMAVL

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SNKVVQTDETARKPDHVPISSEDERNAIFQLEKAILSNEATKSDLQMAVL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

118 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

NCBI Accession Number

NP_060697

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Mucosal Addressin Cell Adhesion Molecule 1 (MAdCAM1) ELISA Kit
NSL0382Po 96 Tests

Porcine Mucosal Addressin Cell Adhesion Molecule 1 (MAdCAM1) ELISA Kit

Sign In for Pricing
View Details
Human C1orf122 knockout cell line
ABC-KH1878 1 Vial

Human C1orf122 knockout cell line

Sign In for Pricing
View Details
ARHGAP6 Protein Vector (Mouse) (pPB-C-His)
PV155854 500 ng

ARHGAP6 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Mouse Xrcc1 Pre-designed siRNA Set A
SI116148A 1 Each

Mouse Xrcc1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Il9 Mouse qPCR Primer Pair (NM_008373)
MP206805 200 Reactions

Il9 Mouse qPCR Primer Pair (NM_008373)

Sign In for Pricing
View Details
Nop16 ORF Vector (Mouse) (pORF)
31999014 1.0 µg DNA

Nop16 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details