Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBA6 Rabbit Polyclonal Antibody (FITC)

UBA6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

E1-L2, MOP-4, UBE1L2

UniProt

A0AVT1

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence SNKVVQTDETARKPDHVPISSEDERNAIFQLEKAILSNEATKSDLQMAVL

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SNKVVQTDETARKPDHVPISSEDERNAIFQLEKAILSNEATKSDLQMAVL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

118 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

NCBI Accession Number

NP_060697

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCMV-Zfp36l2-3xFLAG-Neo Plasmid
PVT65660 2 µg

PCMV-Zfp36l2-3xFLAG-Neo Plasmid

Sign In for Pricing
View Details
Human DNA-directed RNA polymerase III subunit RPC2, POLR3B ELISA Kit
MBS9333579-01 48 Well

Human DNA-directed RNA polymerase III subunit RPC2, POLR3B ELISA Kit

Sign In for Pricing
View Details
Human DNA-directed RNA polymerase III subunit RPC2, POLR3B ELISA Kit
MBS9333579-02 96 Well

Human DNA-directed RNA polymerase III subunit RPC2, POLR3B ELISA Kit

Sign In for Pricing
View Details
Human DNA-directed RNA polymerase III subunit RPC2, POLR3B ELISA Kit
MBS9333579-03 5x 96 Well

Human DNA-directed RNA polymerase III subunit RPC2, POLR3B ELISA Kit

Sign In for Pricing
View Details
Human DNA-directed RNA polymerase III subunit RPC2, POLR3B ELISA Kit
MBS9333579-04 10x 96 Well

Human DNA-directed RNA polymerase III subunit RPC2, POLR3B ELISA Kit

Sign In for Pricing
View Details
4-{[2- (1H-Pyrazol-1-yl) ethyl]amino}benzoic acid
GBC74038-01 50 mg

4-{[2- (1H-Pyrazol-1-yl) ethyl]amino}benzoic acid

Sign In for Pricing
View Details