Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBA6 Rabbit Polyclonal Antibody (HRP)

UBA6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

E1-L2, MOP-4, UBE1L2

UniProt

A0AVT1

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence SNKVVQTDETARKPDHVPISSEDERNAIFQLEKAILSNEATKSDLQMAVL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SNKVVQTDETARKPDHVPISSEDERNAIFQLEKAILSNEATKSDLQMAVL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

118 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

NCBI Accession Number

NP_060697

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cytochrome P450 2E1 (CYP2E1) ELISA Kit
RK02729 96 Tests

Mouse Cytochrome P450 2E1 (CYP2E1) ELISA Kit

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Receptor Superfamily Member 1A / CD120a (TNFRSF1A) ELISA Kit
abx153323-01 96 Tests

Human Tumor Necrosis Factor Receptor Superfamily Member 1A / CD120a (TNFRSF1A) ELISA Kit

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Receptor Superfamily Member 1A / CD120a (TNFRSF1A) ELISA Kit
abx153323-02 5x 96 Tests

Human Tumor Necrosis Factor Receptor Superfamily Member 1A / CD120a (TNFRSF1A) ELISA Kit

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Receptor Superfamily Member 1A / CD120a (TNFRSF1A) ELISA Kit
abx153323-03 10x 96 Tests

Human Tumor Necrosis Factor Receptor Superfamily Member 1A / CD120a (TNFRSF1A) ELISA Kit

Sign In for Pricing
View Details
MED16 rabbit pAb
MBS8599520-01 0.1 mL

MED16 rabbit pAb

Sign In for Pricing
View Details
MED16 rabbit pAb
MBS8599520-02 0.1 mL (AF405L)

MED16 rabbit pAb

Sign In for Pricing
View Details