Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBA6 Rabbit Polyclonal Antibody (HRP)

UBA6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

E1-L2, MOP-4, UBE1L2

UniProt

A0AVT1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human UBA6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EVIVPHLTESYNSHRDPPEEEIPFCTLKSFPAAIEHTIQWARDKFESSFS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

118kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060697

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal AMICA/JAML Antibody
NBP2-14286-25ul 25 µL

Rabbit Polyclonal AMICA/JAML Antibody

Sign In for Pricing
View Details
NSD2 (G-12) Alexa Fluor® 647
sc-365627 AF647 200 µg/mL

NSD2 (G-12) Alexa Fluor® 647

Sign In for Pricing
View Details
NDR1 siRNA (h)
sc-44366 10 µM

NDR1 siRNA (h)

Sign In for Pricing
View Details
TMEM267 Human shRNA Lentiviral Particle (Locus ID 64417)
TL307235V 500 µL Each

TMEM267 Human shRNA Lentiviral Particle (Locus ID 64417)

Sign In for Pricing
View Details
IL24 (NM_001185158) Human Tagged ORF Clone
RC230916 10 µg

IL24 (NM_001185158) Human Tagged ORF Clone

Sign In for Pricing
View Details
SCP2 Antibody Blocking peptide
orb1445000 500 µg

SCP2 Antibody Blocking peptide

Sign In for Pricing
View Details