Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISG15 Rabbit Polyclonal Antibody (Biotin)

ISG15 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

G1P2, IP17, UCRP, IFI15, IMD38, hUCRP

UniProt

P05161

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ISG15

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Porcine, Rabbit, Sheep

Tested Applications

IHC, WB

NCBI Accession Number

NP_005092

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycobacterium tuberculosis Putative DNA-binding protein Rv0500A/MT0521 (Rv0500A, MT0521)
MBS1443251-01 0.02 mg (E-Coli)

Recombinant Mycobacterium tuberculosis Putative DNA-binding protein Rv0500A/MT0521 (Rv0500A, MT0521)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Putative DNA-binding protein Rv0500A/MT0521 (Rv0500A, MT0521)
MBS1443251-02 0.1 mg (E-Coli)

Recombinant Mycobacterium tuberculosis Putative DNA-binding protein Rv0500A/MT0521 (Rv0500A, MT0521)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Putative DNA-binding protein Rv0500A/MT0521 (Rv0500A, MT0521)
MBS1443251-03 0.02 mg (Yeast)

Recombinant Mycobacterium tuberculosis Putative DNA-binding protein Rv0500A/MT0521 (Rv0500A, MT0521)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Putative DNA-binding protein Rv0500A/MT0521 (Rv0500A, MT0521)
MBS1443251-04 0.1 mg (Yeast)

Recombinant Mycobacterium tuberculosis Putative DNA-binding protein Rv0500A/MT0521 (Rv0500A, MT0521)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Putative DNA-binding protein Rv0500A/MT0521 (Rv0500A, MT0521)
MBS1443251-05 0.02 mg (Baculovirus)

Recombinant Mycobacterium tuberculosis Putative DNA-binding protein Rv0500A/MT0521 (Rv0500A, MT0521)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Putative DNA-binding protein Rv0500A/MT0521 (Rv0500A, MT0521)
MBS1443251-06 1 mg (E-Coli)

Recombinant Mycobacterium tuberculosis Putative DNA-binding protein Rv0500A/MT0521 (Rv0500A, MT0521)

Sign In for Pricing
View Details