Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBL4A Rabbit Polyclonal Antibody (Biotin)

UBL4A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GDX, G6PD, GET5, MDY2, UBL4, TMA24, DX254E, DXS254E

UniProt

B7NZQ9

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human UBL4A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTETMEKGFSK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055050

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR1D5, CT (OR1D5, Olfactory receptor 1D5, Olfactory receptor 17-31) (MaxLight 405) discontinued
039331-ML405 100 µL

OR1D5, CT (OR1D5, Olfactory receptor 1D5, Olfactory receptor 17-31) (MaxLight 405) discontinued

Sign In for Pricing
View Details
IKBIP sgRNA CRISPR Lentivector (Human) (Target 3)
K2775404 1.0 µg DNA

IKBIP sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
NF-κ B p65 Rabbit mAb
58544 50 µL

NF-κ B p65 Rabbit mAb

Sign In for Pricing
View Details
pDNR-LIB-MAIP1 Plasmid
PVT27982 2 µg

pDNR-LIB-MAIP1 Plasmid

Sign In for Pricing
View Details
ZNF514 (NM_032788) Human Untagged Clone
SC103592 10 µg

ZNF514 (NM_032788) Human Untagged Clone

Sign In for Pricing
View Details
Human Translocase Of Outer Mitochondrial Membrane 70A (TOMM70A) ELISA Kit
BSKH66215-01 48 Tests

Human Translocase Of Outer Mitochondrial Membrane 70A (TOMM70A) ELISA Kit

Sign In for Pricing
View Details