Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBL4A Rabbit Polyclonal Antibody (HRP)

UBL4A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GDX, G6PD, GET5, MDY2, UBL4, TMA24, DX254E, DXS254E

UniProt

B7NZQ9

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human UBL4A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTETMEKGFSK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055050

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1951R), Biotin conjugate, 0.1mg/mL
BNCB1951-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1951R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RPE-iFluor® 750-streptavidin conjugate
16907-AAT 100 µg

RPE-iFluor® 750-streptavidin conjugate

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB610554 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
Accuris One-Step RT-PCR kit, 50 reactions
PR1100-50 1 Each

Accuris One-Step RT-PCR kit, 50 reactions

Sign In for Pricing
View Details
Texas Red Conjugated Goat Polyclonal Antibody to Rabbit IgG
TA-2307-2 2 mL

Texas Red Conjugated Goat Polyclonal Antibody to Rabbit IgG

Sign In for Pricing
View Details
Phospholipase C epsilon 1 (PLCE1) (NM_016341) Human Recombinant Protein
TP313202M 100 µg

Phospholipase C epsilon 1 (PLCE1) (NM_016341) Human Recombinant Protein

Sign In for Pricing
View Details