Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UFM1 Rabbit Polyclonal Antibody (Biotin)

UFM1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HLD14, BM-002, C13orf20

UniProt

P61960

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human UFM1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

9kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057701

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

10X ViBuffer A, 5 x 1ml
RB0201 5x 1 mL

10X ViBuffer A, 5 x 1ml

Sign In for Pricing
View Details
CD35 / CR1 (CR1/802), 0.2mg/mL
BNUB0802-500 1x 500 µL

CD35 / CR1 (CR1/802), 0.2mg/mL

Sign In for Pricing
View Details
CD25 / IL2RA (Activated Lymphocyte Marker) (IL2RA/2394), CF488A conjugate, 0.1mg/mL
BNC882394-500 1x 500 µL

CD25 / IL2RA (Activated Lymphocyte Marker) (IL2RA/2394), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Melanoma Antigen Family A, 4 / MAGEA4 (CPTC-MAGEA4-1), CF488A conjugate, 0.1mg/mL
BNC882246-100 1x 100 µL

Melanoma Antigen Family A, 4 / MAGEA4 (CPTC-MAGEA4-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2831R), CF405S conjugate, 0.1mg/mL
BNC042831-500 1x 500 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2831R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CRIPT Polyclonal Antibody
E-AB-90809-01 60 µL

CRIPT Polyclonal Antibody

Sign In for Pricing
View Details