Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZER1 Rabbit Polyclonal Antibody (Biotin)

ZER1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZYG, C9orf60, ZYG11BL

UniProt

Q7Z7L7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZER1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YCPLLIKEGGMPLLRDIIKMATARQETKEMARKVIEHCSNFKEENMDTSR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

88kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006327

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,2'- ((2- (4- (carboxymethyl) piperazin-1-yl) ethyl) azanediyl) diacetic acid
RG-E242614-01 10 mg

2,2'- ((2- (4- (carboxymethyl) piperazin-1-yl) ethyl) azanediyl) diacetic acid

Sign In for Pricing
View Details
2,2'- ((2- (4- (carboxymethyl) piperazin-1-yl) ethyl) azanediyl) diacetic acid
RG-E242614-02 100 mg

2,2'- ((2- (4- (carboxymethyl) piperazin-1-yl) ethyl) azanediyl) diacetic acid

Sign In for Pricing
View Details
2,2'- ((2- (4- (carboxymethyl) piperazin-1-yl) ethyl) azanediyl) diacetic acid
RG-E242614-03 25 mg

2,2'- ((2- (4- (carboxymethyl) piperazin-1-yl) ethyl) azanediyl) diacetic acid

Sign In for Pricing
View Details
2,2'- ((2- (4- (carboxymethyl) piperazin-1-yl) ethyl) azanediyl) diacetic acid
RG-E242614-04 50 mg

2,2'- ((2- (4- (carboxymethyl) piperazin-1-yl) ethyl) azanediyl) diacetic acid

Sign In for Pricing
View Details
Lentiviral mouse Lrtm2 shRNA (UAS) - Lentiviral mouse Lrtm2 shRNA (UAS, iRFP) (100)
GTR15279879 1 Vial

Lentiviral mouse Lrtm2 shRNA (UAS) - Lentiviral mouse Lrtm2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
BARD1 Rabbit Polyclonal Antibody (Fluoro647)
orb3113251 100 µg

BARD1 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details