Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZER1 Rabbit Polyclonal Antibody (Biotin)

ZER1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZYG, C9orf60, ZYG11BL

UniProt

Q7Z7L7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZER1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YCPLLIKEGGMPLLRDIIKMATARQETKEMARKVIEHCSNFKEENMDTSR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

88kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006327

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial (CHCHD2) ELISA Kit
MBS7216090-01 48 Well

Canine Coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial (CHCHD2) ELISA Kit

Sign In for Pricing
View Details
Canine Coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial (CHCHD2) ELISA Kit
MBS7216090-02 96 Well

Canine Coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial (CHCHD2) ELISA Kit

Sign In for Pricing
View Details
Canine Coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial (CHCHD2) ELISA Kit
MBS7216090-03 5x 96 Well

Canine Coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial (CHCHD2) ELISA Kit

Sign In for Pricing
View Details
Canine Coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial (CHCHD2) ELISA Kit
MBS7216090-04 10x 96 Well

Canine Coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial (CHCHD2) ELISA Kit

Sign In for Pricing
View Details
AGPAT9 Protein Vector (Rat) (pPM-C-HA)
PV252728 500 ng

AGPAT9 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Immortalized Rat Cavernous Smooth Muscle Cells-SV40
T9460 1x106 cells / 1.0 mL

Immortalized Rat Cavernous Smooth Muscle Cells-SV40

Sign In for Pricing
View Details