Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZER1 Rabbit Polyclonal Antibody (HRP)

ZER1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZYG, C9orf60, ZYG11BL

UniProt

Q7Z7L7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZER1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LTNSEYRSEQSVKLRRQVIQVVLNGMESYQEVTVQRNCCLTLCNFSIPEE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

88kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006327

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tert-Butyl 3- (aminomethyl) -5H,6H,7H,8H-[1,2,4]triazolo[4,3-a]pyrazine-7-carboxylate
AAC99900-01 50 mg

Tert-Butyl 3- (aminomethyl) -5H,6H,7H,8H-[1,2,4]triazolo[4,3-a]pyrazine-7-carboxylate

Sign In for Pricing
View Details
Tert-Butyl 3- (aminomethyl) -5H,6H,7H,8H-[1,2,4]triazolo[4,3-a]pyrazine-7-carboxylate
AAC99900-02 0.5 g

Tert-Butyl 3- (aminomethyl) -5H,6H,7H,8H-[1,2,4]triazolo[4,3-a]pyrazine-7-carboxylate

Sign In for Pricing
View Details
CNPY3, NT (CNPY3, CTG4A, ERDA5, PRAT4A, TNRC5, Protein canopy homolog 3, CTG repeat protein 4a, Expanded repeat-domain protein CAG/CTG 5, Protein associated with TLR4, Trinucleotide repeat-containing gene 5 protein) (APC) discontinued
034055-APC 200 µL

CNPY3, NT (CNPY3, CTG4A, ERDA5, PRAT4A, TNRC5, Protein canopy homolog 3, CTG repeat protein 4a, Expanded repeat-domain protein CAG/CTG 5, Protein associated with TLR4, Trinucleotide repeat-containing gene 5 protein) (APC) discontinued

Sign In for Pricing
View Details
OPRM1 Antibody
MBS8515747-01 0.1 mg

OPRM1 Antibody

Sign In for Pricing
View Details
OPRM1 Antibody
MBS8515747-02 0.1 mL (AF635)

OPRM1 Antibody

Sign In for Pricing
View Details
OPRM1 Antibody
MBS8515747-03 0.1 mL (AF610)

OPRM1 Antibody

Sign In for Pricing
View Details