Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXL12 Rabbit Polyclonal Antibody (FITC)

FBXL12 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Fbl12

UniProt

Q9NXK8

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human FBXL12

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PTEILSSCLTMPKLRVLELQGLGWEGQEAEKILCKGLPHCMVIVRACPKE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060173

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat COX2 (Cytochrome C Oxidase Subunit II) ELISA Kit
EK247150 96 Well

Rat COX2 (Cytochrome C Oxidase Subunit II) ELISA Kit

Sign In for Pricing
View Details
VEGFB Blocking Peptide
33R-7386 0.1 mg

VEGFB Blocking Peptide

Sign In for Pricing
View Details
FBXO43 siRNA (Rat)
CRR5506-01 15 nmol

FBXO43 siRNA (Rat)

Sign In for Pricing
View Details
FBXO43 siRNA (Rat)
CRR5506-02 30 nmol

FBXO43 siRNA (Rat)

Sign In for Pricing
View Details
EIF4E2, NT (Eukaryotic Translation Initiation Factor 4E Type 2, eIF4E Type 2, eIF-4E Type 2, mRNA Cap-binding Protein Type 3, Eukaryotic Translation Initiation Factor 4E-like 3, Eukaryotic Translation Initiation Factor 4E Homologous Protein, mRNA Cap-bind
MBS6475321-01 0.2 mL

EIF4E2, NT (Eukaryotic Translation Initiation Factor 4E Type 2, eIF4E Type 2, eIF-4E Type 2, mRNA Cap-binding Protein Type 3, Eukaryotic Translation Initiation Factor 4E-like 3, Eukaryotic Translation Initiation Factor 4E Homologous Protein, mRNA Cap-bind

Sign In for Pricing
View Details
EIF4E2, NT (Eukaryotic Translation Initiation Factor 4E Type 2, eIF4E Type 2, eIF-4E Type 2, mRNA Cap-binding Protein Type 3, Eukaryotic Translation Initiation Factor 4E-like 3, Eukaryotic Translation Initiation Factor 4E Homologous Protein, mRNA Cap-bind
MBS6475321-02 5x 0.2 mL

EIF4E2, NT (Eukaryotic Translation Initiation Factor 4E Type 2, eIF4E Type 2, eIF-4E Type 2, mRNA Cap-binding Protein Type 3, Eukaryotic Translation Initiation Factor 4E-like 3, Eukaryotic Translation Initiation Factor 4E Homologous Protein, mRNA Cap-bind

Sign In for Pricing
View Details