Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ubash3b Rabbit Polyclonal Antibody (FITC)

Ubash3b Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Sts1, Sts-1, RGD1310357

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Ubash3b

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AHASSLEACTCQLQGLSPQNSKDFVQMVRKIPYLGFCSCEELGETGIWQL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001178721

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tensin-3 (TNS3) ELISA Kit
EK6096 48 Tests

Mouse Tensin-3 (TNS3) ELISA Kit

Sign In for Pricing
View Details
Human Myogenin (MYOG) ELISA Kit
EKL62317 96 Tests

Human Myogenin (MYOG) ELISA Kit

Sign In for Pricing
View Details
C10orf71 Polyclonal Antibody
CAC12882-01 50 µL

C10orf71 Polyclonal Antibody

Sign In for Pricing
View Details
C10orf71 Polyclonal Antibody
CAC12882-02 100 µL

C10orf71 Polyclonal Antibody

Sign In for Pricing
View Details
Xpc Mouse Gene Knockout Kit (CRISPR)
KN519509 1 Kit

Xpc Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NELL1 Antibody
K06310C03D06C-01 50 ug

NELL1 Antibody

Sign In for Pricing
View Details