Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ubash3b Rabbit Polyclonal Antibody (HRP)

Ubash3b Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Sts1, Sts-1, RGD1310357

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Ubash3b

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AHASSLEACTCQLQGLSPQNSKDFVQMVRKIPYLGFCSCEELGETGIWQL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001178721

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Max Antibody [DyLight 488]
NBP1-49963G 0.1 mL

Rabbit Polyclonal Max Antibody [DyLight 488]

Sign In for Pricing
View Details
Itsn2 (NM_001198968) Mouse Tagged ORF Clone
MR231860 10 µg

Itsn2 (NM_001198968) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
KRT8P15 sgRNA CRISPR Lentivector set (Human)
K1167301 3x 1.0 µg

KRT8P15 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
SNRPA (U1 Small Nuclear Ribonucleoprotein A, U1 snRNP A, U1-A, U1A) (PE)
MBS6160411-01 0.1 mL

SNRPA (U1 Small Nuclear Ribonucleoprotein A, U1 snRNP A, U1-A, U1A) (PE)

Sign In for Pricing
View Details
SNRPA (U1 Small Nuclear Ribonucleoprotein A, U1 snRNP A, U1-A, U1A) (PE)
MBS6160411-02 5x 0.1 mL

SNRPA (U1 Small Nuclear Ribonucleoprotein A, U1 snRNP A, U1-A, U1A) (PE)

Sign In for Pricing
View Details
Sequencing Grade V8 Protease
RE014 50 µg

Sequencing Grade V8 Protease

Sign In for Pricing
View Details