Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNTN1 Rabbit Polyclonal Antibody (FITC)

CNTN1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

F3, GP135, MYPCN

UniProt

Q12860

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CNTN1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QLEDEGIYECEAENIRGKDKHQARIYVQAFPEWVEHINDTEVDIGSDLYW

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

111kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001834

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Osbpl7 (NM_001081434) Mouse Tagged ORF Clone Lentiviral Particle
MR221196L4V 200 µL

Osbpl7 (NM_001081434) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ERK3, phosphorylated (S189) (Mitogen-activated protein kinase 6, Extracellular signal-regulated kinase 3, ERK-3, MAP kinase isoform p97, p97-MAPK, MAPK6, ERK3, PRKM6, ) (PE) discontinued
035209-PE 200 µL

ERK3, phosphorylated (S189) (Mitogen-activated protein kinase 6, Extracellular signal-regulated kinase 3, ERK-3, MAP kinase isoform p97, p97-MAPK, MAPK6, ERK3, PRKM6, ) (PE) discontinued

Sign In for Pricing
View Details
Anti-STS Antibody (Monoclonal, 32S53)
M01198 100 µL

Anti-STS Antibody (Monoclonal, 32S53)

Sign In for Pricing
View Details
CD46 (Membrane Cofactor Protein, TLX, Trophoblast Leukocyte Common Antigen, MCP, MIC10, MGC26544) (MaxLight 650)
124635-ML650 100 µL

CD46 (Membrane Cofactor Protein, TLX, Trophoblast Leukocyte Common Antigen, MCP, MIC10, MGC26544) (MaxLight 650)

Sign In for Pricing
View Details
SOX11 Antibody, FITC conjugated
CSB-PA022419LC01HU-01 50 µg

SOX11 Antibody, FITC conjugated

Sign In for Pricing
View Details
SOX11 Antibody, FITC conjugated
CSB-PA022419LC01HU-02 100 µg

SOX11 Antibody, FITC conjugated

Sign In for Pricing
View Details