Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Psenen Rabbit Polyclonal Antibody (HRP)

Psenen Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Pen-2, 1700023M09Rik

UniProt

Q9CQR7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LGGFAFLPFLWLVNIFWFFREAFLAPAYTEQSQIKGYVWRSAVGFLFWVI

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079774

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRMT5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E6]
TA807620BM 100 µL

PRMT5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E6]

Sign In for Pricing
View Details
Carbonic Anhydrase VIII (CPTC-CA8-2), CF405S conjugate, 0.1mg/mL
BNC042232-100 1x 100 µL

Carbonic Anhydrase VIII (CPTC-CA8-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse CD4 Antibody[RM4-5]
E-AB-F1353UQ-01 25 µg

Elab Fluor® Violet 450 Anti-Mouse CD4 Antibody[RM4-5]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse CD4 Antibody[RM4-5]
E-AB-F1353UQ-02 100 µg

Elab Fluor® Violet 450 Anti-Mouse CD4 Antibody[RM4-5]

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS505741 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
APMAP Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D7]
TA504209BM 100 µL

APMAP Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D7]

Sign In for Pricing
View Details