Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Scg3 Rabbit Polyclonal Antibody (FITC)

Scg3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

S, Chgd, SgIII, 1B1075, AI385542

UniProt

P47867

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TGKTEAYLEAIRKNIEWLKKHNKKGNKEDYDLSKMRDFINQQADAYVEKG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001158262

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CIAPIN1 (DRE2, PRO0915, Anamorsin, 2810413N20Rik, Cytokine-induced Apoptosis Inhibitor 1) (PE)
MBS6445655-01 0.1 mL

CIAPIN1 (DRE2, PRO0915, Anamorsin, 2810413N20Rik, Cytokine-induced Apoptosis Inhibitor 1) (PE)

Sign In for Pricing
View Details
CIAPIN1 (DRE2, PRO0915, Anamorsin, 2810413N20Rik, Cytokine-induced Apoptosis Inhibitor 1) (PE)
MBS6445655-02 5x 0.1 mL

CIAPIN1 (DRE2, PRO0915, Anamorsin, 2810413N20Rik, Cytokine-induced Apoptosis Inhibitor 1) (PE)

Sign In for Pricing
View Details
EHD3 Rabbit Polyclonal Antibody
orb626648-01 50 µg

EHD3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EHD3 Rabbit Polyclonal Antibody
orb626648-02 100 µg

EHD3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NFKB1 Rabbit Polyclonal Antibody (BF555)
orb1589833 100 µL

NFKB1 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Bovine Protein Kinase C Iota ELISA Kit
MBS044346-01 48 Well

Bovine Protein Kinase C Iota ELISA Kit

Sign In for Pricing
View Details