Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Syt1 Rabbit Polyclonal Antibody (HRP)

Syt1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SytI, AW124717, G630098F17Rik

UniProt

P46096

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSL

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_033332

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Albumin Human
GWB-A33943 10 g

Albumin Human

Sign In for Pricing
View Details
ZBTB7A, CT (ZBTB7A, FBI1, LRF, ZBTB7, ZNF857A, Zinc finger and BTB domain-containing protein 7A, Factor binding IST protein 1, Factor that binds to inducer of short transcripts protein 1, HIV-1 1st-binding protein 1, Leukemia/lymphoma-related factor, POZ
MBS6364739-01 0.1 mL

ZBTB7A, CT (ZBTB7A, FBI1, LRF, ZBTB7, ZNF857A, Zinc finger and BTB domain-containing protein 7A, Factor binding IST protein 1, Factor that binds to inducer of short transcripts protein 1, HIV-1 1st-binding protein 1, Leukemia/lymphoma-related factor, POZ

Sign In for Pricing
View Details
ZBTB7A, CT (ZBTB7A, FBI1, LRF, ZBTB7, ZNF857A, Zinc finger and BTB domain-containing protein 7A, Factor binding IST protein 1, Factor that binds to inducer of short transcripts protein 1, HIV-1 1st-binding protein 1, Leukemia/lymphoma-related factor, POZ
MBS6364739-02 5x 0.1 mL

ZBTB7A, CT (ZBTB7A, FBI1, LRF, ZBTB7, ZNF857A, Zinc finger and BTB domain-containing protein 7A, Factor binding IST protein 1, Factor that binds to inducer of short transcripts protein 1, HIV-1 1st-binding protein 1, Leukemia/lymphoma-related factor, POZ

Sign In for Pricing
View Details
TTLL7 Antibody
orb41091-01 50 μL

TTLL7 Antibody

Sign In for Pricing
View Details
TTLL7 Antibody
orb41091-02 100 µL

TTLL7 Antibody

Sign In for Pricing
View Details
SEK1/MKK4 (Phospho Ser257/Thr261) Antibody
A9467-01 50 μL

SEK1/MKK4 (Phospho Ser257/Thr261) Antibody

Sign In for Pricing
View Details