Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Syt1 Rabbit Polyclonal Antibody (FITC)

Syt1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P65

UniProt

P21707

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Syt1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDF

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001028852

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AIF1 / Iba1 (Microglia Marker) (AIF1/2493), CF405S conjugate, 0.1mg/mL
BNC042493-500 1x 500 µL

AIF1 / Iba1 (Microglia Marker) (AIF1/2493), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NRXN3 Human Gene Knockout Kit (CRISPR)
KN423448 1 Kit

NRXN3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PROTAC Mcl1 degrader-1 10mg
A18373-10 10 mg

PROTAC Mcl1 degrader-1 10mg

Sign In for Pricing
View Details
MIC1 (Mic-1, Chromosome 18 Open Reading Frame 8, C18orf8, Colon Cancer-associated Protein Mic1, FLJ23453, HsT2591, Uncharacterized Protein C18orf8) (AP)
MBS6488086-01 0.2 mL

MIC1 (Mic-1, Chromosome 18 Open Reading Frame 8, C18orf8, Colon Cancer-associated Protein Mic1, FLJ23453, HsT2591, Uncharacterized Protein C18orf8) (AP)

Sign In for Pricing
View Details
MIC1 (Mic-1, Chromosome 18 Open Reading Frame 8, C18orf8, Colon Cancer-associated Protein Mic1, FLJ23453, HsT2591, Uncharacterized Protein C18orf8) (AP)
MBS6488086-02 5x 0.2 mL

MIC1 (Mic-1, Chromosome 18 Open Reading Frame 8, C18orf8, Colon Cancer-associated Protein Mic1, FLJ23453, HsT2591, Uncharacterized Protein C18orf8) (AP)

Sign In for Pricing
View Details
SDHC (NM_001278172) Human Tagged ORF Clone
RC235729 10 µg

SDHC (NM_001278172) Human Tagged ORF Clone

Sign In for Pricing
View Details