Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cpne6 Rabbit Polyclonal Antibody (FITC)

Cpne6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AU067659, BB076446

UniProt

Q9Z140

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YLQALRTVGGICQDYDSDKRFPAFGFGARIPPNFEVSHDFAINFDPENPE

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034077

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBC1D21 (NM_153356) Human Over-expression Lysate
E45H14862-2 20 µg

TBC1D21 (NM_153356) Human Over-expression Lysate

Sign In for Pricing
View Details
Inhibin beta E chain (INHBE) Rabbit Monoclonal Antibody [Clone ID: OTIR4A6]
TA594441S 30 µL

Inhibin beta E chain (INHBE) Rabbit Monoclonal Antibody [Clone ID: OTIR4A6]

Sign In for Pricing
View Details
RASGEF1C Protein Vector (Rat) (pPB-N-His)
PV298227 500 ng

RASGEF1C Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Porcine Endothelin-Converting Enzyme-Like 1 (ECEL1) ELISA Kit
MBS9397291-01 48 Well

Porcine Endothelin-Converting Enzyme-Like 1 (ECEL1) ELISA Kit

Sign In for Pricing
View Details
Porcine Endothelin-Converting Enzyme-Like 1 (ECEL1) ELISA Kit
MBS9397291-02 96 Well

Porcine Endothelin-Converting Enzyme-Like 1 (ECEL1) ELISA Kit

Sign In for Pricing
View Details
Porcine Endothelin-Converting Enzyme-Like 1 (ECEL1) ELISA Kit
MBS9397291-03 5x 96 Well

Porcine Endothelin-Converting Enzyme-Like 1 (ECEL1) ELISA Kit

Sign In for Pricing
View Details