Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Scamp1 Rabbit Polyclonal Antibody (FITC)

Scamp1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AI415563, AW122395, 4930505M11Rik

UniProt

Q8K021

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GSVKMPNVPNTQPAIMKPTEEHPAYTQITKEHALAQAELLKRQEELERKA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_083429

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANGPTL7 (Angiopoietin-like 7, AngX, CDT6, RP4-647M16.2, dJ647M16.1) (Biotin)
MBS6174444-01 0.1 mL

ANGPTL7 (Angiopoietin-like 7, AngX, CDT6, RP4-647M16.2, dJ647M16.1) (Biotin)

Sign In for Pricing
View Details
ANGPTL7 (Angiopoietin-like 7, AngX, CDT6, RP4-647M16.2, dJ647M16.1) (Biotin)
MBS6174444-02 5x 0.1 mL

ANGPTL7 (Angiopoietin-like 7, AngX, CDT6, RP4-647M16.2, dJ647M16.1) (Biotin)

Sign In for Pricing
View Details
Mouse Regulator Of G Protein Signaling 5 (RGS5) ELISA Kit-Sandwich
EK6F524-01 48 Test

Mouse Regulator Of G Protein Signaling 5 (RGS5) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Mouse Regulator Of G Protein Signaling 5 (RGS5) ELISA Kit-Sandwich
EK6F524-02 96 Tests

Mouse Regulator Of G Protein Signaling 5 (RGS5) ELISA Kit-Sandwich

Sign In for Pricing
View Details
LentimiRa-mmu-miR-6971-3p Vector
mm41666 500 ng

LentimiRa-mmu-miR-6971-3p Vector

Sign In for Pricing
View Details
Anti-DCLK1 Antibody
M03089-1-01 50 µL

Anti-DCLK1 Antibody

Sign In for Pricing
View Details