Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Scamp1 Rabbit Polyclonal Antibody (HRP)

Scamp1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AI415563, AW122395, 4930505M11Rik

UniProt

Q8K021

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GSVKMPNVPNTQPAIMKPTEEHPAYTQITKEHALAQAELLKRQEELERKA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_083429

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA™ Human Suppressor of cytokine signaling 6 (SOCS6) ELISA
KBH6234 1x 96 Well

GENLISA™ Human Suppressor of cytokine signaling 6 (SOCS6) ELISA

Sign In for Pricing
View Details
Pentraxin 2/SAP Protein, Mouse, Recombinant (C-hFc)
E51P00676 100 µg

Pentraxin 2/SAP Protein, Mouse, Recombinant (C-hFc)

Sign In for Pricing
View Details
Mouse Polyclonal PSD3 Antibody
H00023362-B01P-50ug 50 µg

Mouse Polyclonal PSD3 Antibody

Sign In for Pricing
View Details
Human Socs1 (Suppressor of Cytokine Signaling 1) ELISA Kit
FY-EH4087 96 Well

Human Socs1 (Suppressor of Cytokine Signaling 1) ELISA Kit

Sign In for Pricing
View Details
Zfp97 Protein Vector (Mouse) (pPB-C-His)
PV250634 500 ng

Zfp97 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Human PRCP MAb (Clone 860821)
MAB7164-SP 25 µg

Human PRCP MAb (Clone 860821)

Sign In for Pricing
View Details