Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Scamp5 Rabbit Polyclonal Antibody (Biotin)

Scamp5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Sc, Sc5

UniProt

Q9JKD3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VFSFIALSMVHKFYRGSGGSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAA

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_064666

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

GALK1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
21210066 1.0 µg DNA

GALK1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human PKD1 (Protein Kinase D1) ELISA Kit
RE1664H-01 48 Tests

Human PKD1 (Protein Kinase D1) ELISA Kit

Sign In for Pricing
View Details
Human PKD1 (Protein Kinase D1) ELISA Kit
RE1664H-02 96 Tests

Human PKD1 (Protein Kinase D1) ELISA Kit

Sign In for Pricing
View Details
OGN Polyclonal Antibody, FITC Conjugated
A57047-100 100 µL

OGN Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
RXRB, ID (RXRB, NR2B2, Retinoic acid receptor RXR-beta, Nuclear receptor subfamily 2 group B member 2, Retinoid X receptor beta) (MaxLight 405) discontinued
041348-ML405 100 µL

RXRB, ID (RXRB, NR2B2, Retinoic acid receptor RXR-beta, Nuclear receptor subfamily 2 group B member 2, Retinoid X receptor beta) (MaxLight 405) discontinued

Sign In for Pricing
View Details
IKZF3 Rabbit mAb
59978 50 µL

IKZF3 Rabbit mAb

Sign In for Pricing
View Details