Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYT11 Rabbit Polyclonal Antibody (FITC)

SYT11 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SYT12, sytXI

UniProt

Q9BT88

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SYT11

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELRSPITSLTPGESKTTSPS

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse

Tested Applications

WB

NCBI Accession Number

NP_689493

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE-Linked Monoclonal Antibody to Cross Linked C-Telopeptide Of Type I Collagen (CTXI)
MBS2149796-01 0.1 mL

PE-Linked Monoclonal Antibody to Cross Linked C-Telopeptide Of Type I Collagen (CTXI)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Cross Linked C-Telopeptide Of Type I Collagen (CTXI)
MBS2149796-02 0.2 mL

PE-Linked Monoclonal Antibody to Cross Linked C-Telopeptide Of Type I Collagen (CTXI)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Cross Linked C-Telopeptide Of Type I Collagen (CTXI)
MBS2149796-03 0.5 mL

PE-Linked Monoclonal Antibody to Cross Linked C-Telopeptide Of Type I Collagen (CTXI)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Cross Linked C-Telopeptide Of Type I Collagen (CTXI)
MBS2149796-04 1 mL

PE-Linked Monoclonal Antibody to Cross Linked C-Telopeptide Of Type I Collagen (CTXI)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Cross Linked C-Telopeptide Of Type I Collagen (CTXI)
MBS2149796-05 5 mL

PE-Linked Monoclonal Antibody to Cross Linked C-Telopeptide Of Type I Collagen (CTXI)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Cross Linked C-Telopeptide Of Type I Collagen (CTXI)
MBS2149796-06 5x 5 mL

PE-Linked Monoclonal Antibody to Cross Linked C-Telopeptide Of Type I Collagen (CTXI)

Sign In for Pricing
View Details