Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYT16 Rabbit Polyclonal Antibody (HRP)

SYT16 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SYT14L, syt14r, Strep14, CHR14SYT

UniProt

Q17RD7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SYT16

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DKLDQDLDNIQIQETYFEDEEQDNDWSQEDANSLFLEVDHFSCCNSDLQD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_114120

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pass Box BSPB-103
BSPB-103 1 Unit

Pass Box BSPB-103

Sign In for Pricing
View Details
Recombinant Mouse LIX Protein (Sumo Tag)
PDEM100138-01 20 µg

Recombinant Mouse LIX Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Mouse LIX Protein (Sumo Tag)
PDEM100138-02 100 µg

Recombinant Mouse LIX Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Mouse LIX Protein (Sumo Tag)
PDEM100138-03 500 µg

Recombinant Mouse LIX Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Mouse LIX Protein (Sumo Tag)
PDEM100138-04 1 mg

Recombinant Mouse LIX Protein (Sumo Tag)

Sign In for Pricing
View Details
Slc39a9 Mouse Gene Knockout Kit (CRISPR)
KN516113 1 Kit

Slc39a9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details