Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stx1a Rabbit Polyclonal Antibody (FITC)

Stx1a Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HPC-, HPC-1

UniProt

O35526

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSD

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_058081

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Anti-Human IgG+IgM+IgA - Alexa Fluor 790
E51S4206 100 µL

Goat Anti-Human IgG+IgM+IgA - Alexa Fluor 790

Sign In for Pricing
View Details
X-Ray Repair Cross Complementing 6 (XRCC6) Antibody
abx149596 100 µg

X-Ray Repair Cross Complementing 6 (XRCC6) Antibody

Sign In for Pricing
View Details
ProMag 3 Series Protein G
PMG3N-10 10 mL

ProMag 3 Series Protein G

Sign In for Pricing
View Details
PATZ1 (POZ-, AT Hook-, and Zinc Finger-containing Protein 1, BTB/POZ Domain Zinc Finger Transcription Factor, Protein Kinase A RI Subunit alpha-associated Protein, Zinc Finger and BTB Domain-containing Protein 19, Zinc Finger Protein 278, Zinc Finger Sarcoma Gene Protein, PATZ, RIAZ, ZBTB19, ZNF278, ZSG) (MaxLight 550)
130898-ML550 100 µL

PATZ1 (POZ-, AT Hook-, and Zinc Finger-containing Protein 1, BTB/POZ Domain Zinc Finger Transcription Factor, Protein Kinase A RI Subunit alpha-associated Protein, Zinc Finger and BTB Domain-containing Protein 19, Zinc Finger Protein 278, Zinc Finger Sarcoma Gene Protein, PATZ, RIAZ, ZBTB19, ZNF278, ZSG) (MaxLight 550)

Sign In for Pricing
View Details
Spata2 Mouse shRNA Plasmid (Locus ID 263876)
TL509192 1 Kit

Spata2 Mouse shRNA Plasmid (Locus ID 263876)

Sign In for Pricing
View Details
Choline Acetyltransferase Rabbit mAb
MBS4752659-01 0.1 mL

Choline Acetyltransferase Rabbit mAb

Sign In for Pricing
View Details