Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYT12 Rabbit Polyclonal Antibody (FITC)

SYT12 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SYT11, sytXII

UniProt

Q8IV01

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SYT12

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LLGIAAVSLWKLWTSGSFPSPSPFPNYDYRYLQQKYGESCAEAREKRVPA

Field of Research

Neuroscience

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Porcine, Rabbit

NCBI Accession Number

NP_001171351

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAS2R31, CT (TAS2R31, TAS2R44, Taste receptor type 2 member 31, Taste receptor type 2 member 44, Taste receptor type 2 member 53) (MaxLight 650)
MBS6353707-01 0.1 mL

TAS2R31, CT (TAS2R31, TAS2R44, Taste receptor type 2 member 31, Taste receptor type 2 member 44, Taste receptor type 2 member 53) (MaxLight 650)

Sign In for Pricing
View Details
TAS2R31, CT (TAS2R31, TAS2R44, Taste receptor type 2 member 31, Taste receptor type 2 member 44, Taste receptor type 2 member 53) (MaxLight 650)
MBS6353707-02 5x 0.1 mL

TAS2R31, CT (TAS2R31, TAS2R44, Taste receptor type 2 member 31, Taste receptor type 2 member 44, Taste receptor type 2 member 53) (MaxLight 650)

Sign In for Pricing
View Details
Human anti-insulin receptor antibody (AIRA) ELISA Kit
YP-W10909-01 48 Tests

Human anti-insulin receptor antibody (AIRA) ELISA Kit

Sign In for Pricing
View Details
Human anti-insulin receptor antibody (AIRA) ELISA Kit
YP-W10909-02 96 Tests

Human anti-insulin receptor antibody (AIRA) ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal TRPC1 Antibody (1V3Q2)
NBP3-16315-100ul 100 µL

Rabbit Monoclonal TRPC1 Antibody (1V3Q2)

Sign In for Pricing
View Details
RFX5 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
38883156 3x 1.0 µg DNA

RFX5 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details