Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BNIP1 Rabbit Polyclonal Antibody (HRP)

BNIP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NIP1, SEC20, TRG-8

UniProt

Q12981

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human BNIP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001196

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Peroxiredoxin-5 Antibody (Biotin)
KB-1126-01 50 μL

Peroxiredoxin-5 Antibody (Biotin)

Sign In for Pricing
View Details
Peroxiredoxin-5 Antibody (Biotin)
KB-1126-02 100 µL

Peroxiredoxin-5 Antibody (Biotin)

Sign In for Pricing
View Details
Peroxiredoxin-5 Antibody (Biotin)
KB-1126-03 1 mL

Peroxiredoxin-5 Antibody (Biotin)

Sign In for Pricing
View Details
Neurotrophic Factor for Retinal Cholinergic Neurons
SP-100435-1 1 mg

Neurotrophic Factor for Retinal Cholinergic Neurons

Sign In for Pricing
View Details
Hepatitis C Virus NS3 (HCV) (APC) discontinued
H1920-22W1-APC 100 µL

Hepatitis C Virus NS3 (HCV) (APC) discontinued

Sign In for Pricing
View Details
SHOC2 (Leucine-Rich Repeat Protein SHOC-2, Soc-2 Suppressor of Clear Homolog (C. Elegans) )
491687 100 µL

SHOC2 (Leucine-Rich Repeat Protein SHOC-2, Soc-2 Suppressor of Clear Homolog (C. Elegans) )

Sign In for Pricing
View Details