Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BNIP1 Rabbit Polyclonal Antibody (HRP)

BNIP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NIP1, SEC20, TRG-8

UniProt

Q12981

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human BNIP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DFNSPTTPVTFSDLEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRK

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_053582

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-P-Selectin Glycoprotein Ligand 1 (PSGL1)
FY-AB46951-01 1 mL

Anti-P-Selectin Glycoprotein Ligand 1 (PSGL1)

Sign In for Pricing
View Details
Anti-P-Selectin Glycoprotein Ligand 1 (PSGL1)
FY-AB46951-02 100 µL

Anti-P-Selectin Glycoprotein Ligand 1 (PSGL1)

Sign In for Pricing
View Details
Anti-P-Selectin Glycoprotein Ligand 1 (PSGL1)
FY-AB46951-03 200 µL

Anti-P-Selectin Glycoprotein Ligand 1 (PSGL1)

Sign In for Pricing
View Details
Keratinocyte Growth Factor 2, Recombinant, Human (KGF2) discontinued
K0201-15-01 5 µg

Keratinocyte Growth Factor 2, Recombinant, Human (KGF2) discontinued

Sign In for Pricing
View Details
Keratinocyte Growth Factor 2, Recombinant, Human (KGF2) discontinued
K0201-15-02 25 µg

Keratinocyte Growth Factor 2, Recombinant, Human (KGF2) discontinued

Sign In for Pricing
View Details
MMP8/CLG1, Recombinant, Human, His-Tag discontinued
591284-01 20 µg

MMP8/CLG1, Recombinant, Human, His-Tag discontinued

Sign In for Pricing
View Details