Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GOSR1 Rabbit Polyclonal Antibody (Biotin)

GOSR1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P28, GS28, GOS28, GOLIM2, GOS-28, GOS28/P28

UniProt

O95249

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GOSR1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IHSKMNTLANRFPAVNSLIQRINLRKRRDSLILGGVIGICTILLLLYAFH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004862

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Minichromosome Maintenance Deficient 2 (MCM2) ELISA Kit
RD-MCM2-Hu-01 96 Tests

Human Minichromosome Maintenance Deficient 2 (MCM2) ELISA Kit

Sign In for Pricing
View Details
Human Minichromosome Maintenance Deficient 2 (MCM2) ELISA Kit
RD-MCM2-Hu-02 48 Tests

Human Minichromosome Maintenance Deficient 2 (MCM2) ELISA Kit

Sign In for Pricing
View Details
Adamts4 Mouse Gene Knockout Kit (CRISPR)
KN500861 1 Kit

Adamts4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
R3HCC1 Human Gene Knockout Kit (CRISPR)
KN426560 1 Kit

R3HCC1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Elongation factor 1-gamma Rabbit Polyclonal Antibody
HA500164 100 µL

Elongation factor 1-gamma Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Armenian Hamster IgG Isotype Control[PIP]
E-AB-F09853R-01 25 µg

Elab Fluor® Violet 500 Armenian Hamster IgG Isotype Control[PIP]

Sign In for Pricing
View Details