Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Snap29 Rabbit Polyclonal Antibody (HRP)

Snap29 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Gs32

UniProt

Q9JI56

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Snap29

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QPSSRLKEAINTSKDQESKYQASHPNLRRLHDAELDSVPASTVNTEVYPK

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_446262

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGN1P21 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV763164 1.0 µg DNA

HMGN1P21 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Cullin 7 Polyclonal Antibody, RBITC Conjugated
bs-9127R-RBITC 100 µL

Cullin 7 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Polyclonal Antibody to Family With Sequence Similarity 20, Member A (FAM20A)
MBS2026377-01 0.1 mL

Polyclonal Antibody to Family With Sequence Similarity 20, Member A (FAM20A)

Sign In for Pricing
View Details
Polyclonal Antibody to Family With Sequence Similarity 20, Member A (FAM20A)
MBS2026377-02 0.2 mL

Polyclonal Antibody to Family With Sequence Similarity 20, Member A (FAM20A)

Sign In for Pricing
View Details
Polyclonal Antibody to Family With Sequence Similarity 20, Member A (FAM20A)
MBS2026377-03 0.5 mL

Polyclonal Antibody to Family With Sequence Similarity 20, Member A (FAM20A)

Sign In for Pricing
View Details
Polyclonal Antibody to Family With Sequence Similarity 20, Member A (FAM20A)
MBS2026377-04 1 mL

Polyclonal Antibody to Family With Sequence Similarity 20, Member A (FAM20A)

Sign In for Pricing
View Details