Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STX4 Rabbit Polyclonal Antibody (FITC)

STX4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

STX4A, p35-2

UniProt

Q12846

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human STX4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VEMQGEMINRIEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004595

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPN60II Antibody
orb837353 2 mg

CPN60II Antibody

Sign In for Pricing
View Details
Lentiviral mouse Cdkn2aipnl shRNA (UAS) - Lentiviral mouse Cdkn2aipnl shRNA (UAS, RFP) (25)
GTR15301130 1 Vial

Lentiviral mouse Cdkn2aipnl shRNA (UAS) - Lentiviral mouse Cdkn2aipnl shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Human BNIP3 (Bcl2/Adenovirus E1B 19kDa Interacting Protein 3) ELISA Kit
EK247818 96 Well

Human BNIP3 (Bcl2/Adenovirus E1B 19kDa Interacting Protein 3) ELISA Kit

Sign In for Pricing
View Details
Recombinant Oncorhynchus mykiss C5a anaphylatoxin chemotactic receptor (c5ar1)
orb2905420-01 20 µg

Recombinant Oncorhynchus mykiss C5a anaphylatoxin chemotactic receptor (c5ar1)

Sign In for Pricing
View Details
Recombinant Oncorhynchus mykiss C5a anaphylatoxin chemotactic receptor (c5ar1)
orb2905420-02 100 µg

Recombinant Oncorhynchus mykiss C5a anaphylatoxin chemotactic receptor (c5ar1)

Sign In for Pricing
View Details
FSH beta (FSHB) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E10]
TA501623AM 100 µL

FSH beta (FSHB) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E10]

Sign In for Pricing
View Details