Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STX4 Rabbit Polyclonal Antibody (FITC)

STX4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

STX4A, p35-2

UniProt

Q12846

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human STX4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VEMQGEMINRIEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004595

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrin-linked protein kinase Polyclonal Antibody
42192 100 µg

Integrin-linked protein kinase Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human CEP112 Protein, N-GST & C-His
orb3154405-01 50 µg

Recombinant Human CEP112 Protein, N-GST & C-His

Sign In for Pricing
View Details
Recombinant Human CEP112 Protein, N-GST & C-His
orb3154405-02 100 µg

Recombinant Human CEP112 Protein, N-GST & C-His

Sign In for Pricing
View Details
Recombinant Human CEP112 Protein, N-GST & C-His
orb3154405-03 1 mg

Recombinant Human CEP112 Protein, N-GST & C-His

Sign In for Pricing
View Details
Coagulation Factor II, Thrombin / Prothrombin (F2) Antibody Pair
abx370191-01 5x 96 Tests

Coagulation Factor II, Thrombin / Prothrombin (F2) Antibody Pair

Sign In for Pricing
View Details
Coagulation Factor II, Thrombin / Prothrombin (F2) Antibody Pair
abx370191-02 10x 96 Tests

Coagulation Factor II, Thrombin / Prothrombin (F2) Antibody Pair

Sign In for Pricing
View Details