Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vamp8 Rabbit Polyclonal Antibody (FITC)

Vamp8 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Edb, endo, AU041171, endobrevin

UniProt

O70404

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NVERILARGENLDHLRNKTEDLEATSEHFKTTSQKVARKFWWKNVKMIVI

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_058074

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kcnh1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7127005 3x 1.0 µg

Kcnh1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Spag1 Rat shRNA Plasmid (Locus ID 315033)
TR701625 1 Kit

Spag1 Rat shRNA Plasmid (Locus ID 315033)

Sign In for Pricing
View Details
LOC683626 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6468402 1.0 µg DNA

LOC683626 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Neoscript One-Step RT-qPCR Master Mix with UNG (Universal ROX)
BR1F102-02 500 Tests

Neoscript One-Step RT-qPCR Master Mix with UNG (Universal ROX)

Sign In for Pricing
View Details
Rabbit Polyclonal DNAJB2 Antibody
H00003300-D01P 0.1 mg

Rabbit Polyclonal DNAJB2 Antibody

Sign In for Pricing
View Details
Human ELK1 Recombinant Protein (N-GST & C-His)
HB988022-01 50 µg

Human ELK1 Recombinant Protein (N-GST & C-His)

Sign In for Pricing
View Details