Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vamp8 Rabbit Polyclonal Antibody (FITC)

Vamp8 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Edb, endo, AU041171, endobrevin

UniProt

O70404

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NVERILARGENLDHLRNKTEDLEATSEHFKTTSQKVARKFWWKNVKMIVI

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_058074

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C12orf74 activation kit by CRISPRa
GA117392 1 Kit

Human C12orf74 activation kit by CRISPRa

Sign In for Pricing
View Details
Anti-GJA4 Antibody Picoband®, Cy3 Conjugate
A05569-1-Cy3 100 µg/Vial

Anti-GJA4 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
Helicobacter pylori trxA/Thioredoxin Monoclonal Mouse Monoclonal Antibody
orb2956215-01 50 µg

Helicobacter pylori trxA/Thioredoxin Monoclonal Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Helicobacter pylori trxA/Thioredoxin Monoclonal Mouse Monoclonal Antibody
orb2956215-02 100 µg

Helicobacter pylori trxA/Thioredoxin Monoclonal Mouse Monoclonal Antibody

Sign In for Pricing
View Details
C11orf59 3'UTR Lenti-reporter-Luc Vector
13705081 1.0 µg

C11orf59 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
ATF2 Antibody (Phospho-Thr73 or 55) : Biotin (OAAF07680-Biotin)
OAAF07680-100UG-Biotin 100 µg

ATF2 Antibody (Phospho-Thr73 or 55) : Biotin (OAAF07680-Biotin)

Sign In for Pricing
View Details