Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAC1 Rabbit Polyclonal Antibody (HRP)

TAC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NK2, NPK, NKNA, TAC2, Hs.2563

UniProt

P20366

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TAC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEH

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Sheep, Yeast

Tested Applications

WB

NCBI Accession Number

NP_054703

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-BPNT2 Antibody Picoband® Fluoro488 Conjugated
A11341-2-Fluoro488 100 µg/Vial

Anti-BPNT2 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Recombinant Chlorokybus atmophyticus NAD (P)H-quinone oxidoreductase subunit H, chloroplastic (ndhH)
MBS1361152-01 0.02 mg (E-Coli)

Recombinant Chlorokybus atmophyticus NAD (P)H-quinone oxidoreductase subunit H, chloroplastic (ndhH)

Sign In for Pricing
View Details
Recombinant Chlorokybus atmophyticus NAD (P)H-quinone oxidoreductase subunit H, chloroplastic (ndhH)
MBS1361152-02 0.02 mg (Yeast)

Recombinant Chlorokybus atmophyticus NAD (P)H-quinone oxidoreductase subunit H, chloroplastic (ndhH)

Sign In for Pricing
View Details
Recombinant Chlorokybus atmophyticus NAD (P)H-quinone oxidoreductase subunit H, chloroplastic (ndhH)
MBS1361152-03 0.1 mg (E-Coli)

Recombinant Chlorokybus atmophyticus NAD (P)H-quinone oxidoreductase subunit H, chloroplastic (ndhH)

Sign In for Pricing
View Details
Recombinant Chlorokybus atmophyticus NAD (P)H-quinone oxidoreductase subunit H, chloroplastic (ndhH)
MBS1361152-04 0.1 mg (Yeast)

Recombinant Chlorokybus atmophyticus NAD (P)H-quinone oxidoreductase subunit H, chloroplastic (ndhH)

Sign In for Pricing
View Details
Recombinant Chlorokybus atmophyticus NAD (P)H-quinone oxidoreductase subunit H, chloroplastic (ndhH)
MBS1361152-05 0.02 mg (Baculovirus)

Recombinant Chlorokybus atmophyticus NAD (P)H-quinone oxidoreductase subunit H, chloroplastic (ndhH)

Sign In for Pricing
View Details