Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRP Rabbit Polyclonal Antibody (HRP)

GRP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BN, GRP-10, proGRP, preproGRP

UniProt

P07492

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKGSQREGRNPQLNQQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001012530

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA1715 3'UTR GFP Stable Cell Line
TU061729 1.0 mL

KIAA1715 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
SEMA4C Protein Vector (Human) (pPB-N-His)
PV057562 500 ng

SEMA4C Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Rabbit anti-human Lupus La protein polyclonal Antibody, FITC
MBS1490526-01 0.05 mg

Rabbit anti-human Lupus La protein polyclonal Antibody, FITC

Sign In for Pricing
View Details
Rabbit anti-human Lupus La protein polyclonal Antibody, FITC
MBS1490526-02 0.1 mg

Rabbit anti-human Lupus La protein polyclonal Antibody, FITC

Sign In for Pricing
View Details
Rabbit anti-human Lupus La protein polyclonal Antibody, FITC
MBS1490526-03 5x 0.1 mg

Rabbit anti-human Lupus La protein polyclonal Antibody, FITC

Sign In for Pricing
View Details
CCL3 (C-C Motif Chemokine 3, G0/G1 Switch Regulatory Protein 19-1, Macrophage Inflammatory Protein 1-alpha, MIP-1-alpha, PAT 464.1, SIS-beta, Small-inducible Cytokine A3, Tonsillar Lymphocyte LD78 alpha Protein, G0S19-1, MIP1A, SCYA3) (MaxLight 405) discontinued
143655-ML405 100 µL

CCL3 (C-C Motif Chemokine 3, G0/G1 Switch Regulatory Protein 19-1, Macrophage Inflammatory Protein 1-alpha, MIP-1-alpha, PAT 464.1, SIS-beta, Small-inducible Cytokine A3, Tonsillar Lymphocyte LD78 alpha Protein, G0S19-1, MIP1A, SCYA3) (MaxLight 405) discontinued

Sign In for Pricing
View Details