Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCSK2 Rabbit Polyclonal Antibody (Biotin)

PCSK2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PC2, NEC2, SPC2, NEC 2, NEC-2

UniProt

Q5REC2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PCSK2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LASTFSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002585

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Matrix Metalloproteinase 7 (MMP7) ELISA Kit
MBS454760-01 48 Tests

Bovine Matrix Metalloproteinase 7 (MMP7) ELISA Kit

Sign In for Pricing
View Details
Bovine Matrix Metalloproteinase 7 (MMP7) ELISA Kit
MBS454760-02 96 Tests

Bovine Matrix Metalloproteinase 7 (MMP7) ELISA Kit

Sign In for Pricing
View Details
Bovine Matrix Metalloproteinase 7 (MMP7) ELISA Kit
MBS454760-03 5x 96 Tests

Bovine Matrix Metalloproteinase 7 (MMP7) ELISA Kit

Sign In for Pricing
View Details
Bovine Matrix Metalloproteinase 7 (MMP7) ELISA Kit
MBS454760-04 10x 96 Tests

Bovine Matrix Metalloproteinase 7 (MMP7) ELISA Kit

Sign In for Pricing
View Details
Adcy2 Mouse shRNA Plasmid (Locus ID 210044)
TR506288 1 Kit

Adcy2 Mouse shRNA Plasmid (Locus ID 210044)

Sign In for Pricing
View Details
Ndufs2 ORF Vector (Mouse) (pORF)
ORF051181 1.0 µg DNA

Ndufs2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details