Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSTR2 Rabbit Polyclonal Antibody (FITC)

SSTR2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

P30874

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SSTR2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPAL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001041

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF2B3, CT (EIF2B3, Translation initiation factor eIF-2B subunit gamma, eIF-2B GDP-GTP exchange factor subunit gamma) (APC)
MBS6294886-01 0.2 mL

EIF2B3, CT (EIF2B3, Translation initiation factor eIF-2B subunit gamma, eIF-2B GDP-GTP exchange factor subunit gamma) (APC)

Sign In for Pricing
View Details
EIF2B3, CT (EIF2B3, Translation initiation factor eIF-2B subunit gamma, eIF-2B GDP-GTP exchange factor subunit gamma) (APC)
MBS6294886-02 5x 0.2 mL

EIF2B3, CT (EIF2B3, Translation initiation factor eIF-2B subunit gamma, eIF-2B GDP-GTP exchange factor subunit gamma) (APC)

Sign In for Pricing
View Details
OCLN Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-1495R-APC-Cy5.5 100 µL

OCLN Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
VEGF Receptor 2 (KDR) pTyr1175 Rabbit Polyclonal Antibody
AP02382PU-N 100 µL

VEGF Receptor 2 (KDR) pTyr1175 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human DNAJC3 shRNA (UAS) - Lentiviral human DNAJC3 shRNA (UAS, GFP) (100)
GTR15319668 1 Vial

Lentiviral human DNAJC3 shRNA (UAS) - Lentiviral human DNAJC3 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Histone H3 (tri methyl K9) Mouse Monoclonal Antibody (AP)
orb968904 100 µL

Histone H3 (tri methyl K9) Mouse Monoclonal Antibody (AP)

Sign In for Pricing
View Details