Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSTR2 Rabbit Polyclonal Antibody (HRP)

SSTR2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P30874

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SSTR2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPAL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001041

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TSHR shRNA (UAS) - Lentiviral human TSHR shRNA (UAS, GFP) (25)
GTR15154196 1 Vial

Lentiviral human TSHR shRNA (UAS) - Lentiviral human TSHR shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Annexin A3 Antibody (YA6476, Mouse)
HY-P86783-01 10 µL

Annexin A3 Antibody (YA6476, Mouse)

Sign In for Pricing
View Details
Annexin A3 Antibody (YA6476, Mouse)
HY-P86783-02 50 μL

Annexin A3 Antibody (YA6476, Mouse)

Sign In for Pricing
View Details
Annexin A3 Antibody (YA6476, Mouse)
HY-P86783-03 100 µL

Annexin A3 Antibody (YA6476, Mouse)

Sign In for Pricing
View Details
23 x 14 cm DNA Plus high capacity gel system, includes four 50-tooth combs
3431-4000 1 Each

23 x 14 cm DNA Plus high capacity gel system, includes four 50-tooth combs

Sign In for Pricing
View Details
PSD2 (NM_032289) Human Over-expression Lysate
LS084249-20ug 20 µg

PSD2 (NM_032289) Human Over-expression Lysate

Sign In for Pricing
View Details