Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSR5 Rabbit Polyclonal Antibody (FITC)

SSR5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SS-5-R

UniProt

P35346

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SSR5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGC

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

NCBI Accession Number

NP_001044

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCNM1 Antibody
orb681088 100 µL

SCNM1 Antibody

Sign In for Pricing
View Details
PFN1 Antibody
orb522868-01 50 μL

PFN1 Antibody

Sign In for Pricing
View Details
PFN1 Antibody
orb522868-02 100 µL

PFN1 Antibody

Sign In for Pricing
View Details
Lentiviral human DYNC1LI1 shRNA (UAS) - Lentiviral human DYNC1LI1 shRNA (UAS, RFP) (100)
GTR15353919 1 Vial

Lentiviral human DYNC1LI1 shRNA (UAS) - Lentiviral human DYNC1LI1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
AP3B1 Protein Vector (Rat) (pPM-C-HA)
PV253920 500 ng

AP3B1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Cy3 Linked Polyclonal Antibody to Thyroid Stimulating Hormone Receptor (TSHR)
MBS2135471-01 0.1 mL

Cy3 Linked Polyclonal Antibody to Thyroid Stimulating Hormone Receptor (TSHR)

Sign In for Pricing
View Details